Lineage for d1g6ri1 (1g6r I:182-274)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784629Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 784774Domain d1g6ri1: 1g6r I:182-274 [20813]
    Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh2, d1g6ri2, d1g6rl_, d1g6rm_

Details for d1g6ri1

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
PDB Compounds: (I:) major histocompatibility complex class I molecule

SCOP Domain Sequences for d1g6ri1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6ri1 b.1.1.2 (I:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1g6ri1:

Click to download the PDB-style file with coordinates for d1g6ri1.
(The format of our PDB-style files is described here.)

Timeline for d1g6ri1: