| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Rheum palmatum [TaxId:137221] [225816] (3 PDB entries) |
| Domain d3a5sb2: 3a5s B:229-382 [208123] automated match to d1bi5a2 |
PDB Entry: 3a5s (more details), 1.8 Å
SCOPe Domain Sequences for d3a5sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5sb2 c.95.1.0 (B:229-382) automated matches {Rheum palmatum [TaxId: 137221]}
ifelvstaqtivpeshgaieghllesglsfhlyktvptlisnniktclsdaftplnisdw
nslfwiahpggpaildqvtakvglekeklkvtrqvlkdygnmssatvffimdemrkksle
ngqattgeglewgvlfgfgpgitvetvvlrsvpv
Timeline for d3a5sb2: