SCOPe 2.07: Domain d3a5sa2: 3a5s A:229-383

Lineage for d3a5sa2 (3a5s A:229-383)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Rheum palmatum [TaxId:137221] [225816] (3 PDB entries)

8. Domain d3a5sa2: 3a5s A:229-383 [208121]
   automated match to d1bi5a2

Details for d3a5sa2

PDB Entry: 3a5s, 1.8 Å

PDB Description: benzalacetone synthase (i207l/l208f)

PDB Compounds: (A:) Benzalacetone synthase

SCOPe Domain Sequences for d3a5sa2:

Sequence; same for both SEQRES and ATOM records:

>d3a5sa2 c.95.1.0 (A:229-383) automated matches {Rheum palmatum [TaxId: 137221]}
ifelvstaqtivpeshgaieghllesglsfhlyktvptlisnniktclsdaftplnisdw
nslfwiahpggpaildqvtakvglekeklkvtrqvlkdygnmssatvffimdemrkksle
ngqattgeglewgvlfgfgpgitvetvvlrsvpvi

Timeline for d3a5sa2:

• d3a5sa2 first appeared in SCOPe 2.03
  
• d3a5sa2 appears in SCOPe 2.06
  
• d3a5sa2 appears in the current release, SCOPe 2.08