Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Rheum palmatum [TaxId:137221] [225816] (3 PDB entries) |
Domain d3a5sa2: 3a5s A:229-383 [208121] automated match to d1bi5a2 |
PDB Entry: 3a5s (more details), 1.8 Å
SCOPe Domain Sequences for d3a5sa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5sa2 c.95.1.0 (A:229-383) automated matches {Rheum palmatum [TaxId: 137221]} ifelvstaqtivpeshgaieghllesglsfhlyktvptlisnniktclsdaftplnisdw nslfwiahpggpaildqvtakvglekeklkvtrqvlkdygnmssatvffimdemrkksle ngqattgeglewgvlfgfgpgitvetvvlrsvpvi
Timeline for d3a5sa2: