SCOPe 2.07: Domain d1g6rl_: 1g6r L:

Lineage for d1g6rl_ (1g6r L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1g6rl_: 1g6r L: [20812]
   Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2

Details for d1g6rl_

PDB Entry: 1g6r, 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

PDB Compounds: (L:) beta-2 microglobulin

SCOPe Domain Sequences for d1g6rl_:

Sequence; same for both SEQRES and ATOM records:

>d1g6rl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1g6rl_:

• d1g6rl_ first appeared (with stable ids) in SCOP 1.55, called d1g6rl1
  
• d1g6rl_ appears in SCOPe 2.06
  
• d1g6rl_ appears in the current release, SCOPe 2.08