Lineage for d1g6rl1 (1g6r L:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8326Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries)
  8. 8355Domain d1g6rl1: 1g6r L: [20812]
    Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh2, d1g6ri2

Details for d1g6rl1

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1g6rl1:

Click to download the PDB-style file with coordinates for d1g6rl1.
(The format of our PDB-style files is described here.)

Timeline for d1g6rl1: