Lineage for d1g6rl1 (1g6r L:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) 
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries) 
Domain d1g6rl1: 1g6r L: [20812]
Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh2, d1g6ri2
Details for d1g6rl1
PDB Entry: 1g6r (more details), 2.8 Å
PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
SCOP Domain Sequences for d1g6rl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6rl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d1g6rl1:
Click to download the PDB-style file with coordinates for d1g6rl1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6rl1:
- d1g6rl1 appears in SCOP 1.57
- d1g6rl1 appears in the current release, SCOPe 2.08, called d1g6rl_
View in 3D
