Lineage for d3a5ra2 (3a5r A:229-383)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525476Species Rheum palmatum [TaxId:137221] [225816] (3 PDB entries)
  8. 2525478Domain d3a5ra2: 3a5r A:229-383 [208117]
    automated match to d1bi5a2
    complexed with hc4

Details for d3a5ra2

PDB Entry: 3a5r (more details), 1.6 Å

PDB Description: Benzalacetone synthase from Rheum palmatum complexed with 4-coumaroyl-primed monoketide intermediate
PDB Compounds: (A:) Benzalacetone synthase

SCOPe Domain Sequences for d3a5ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5ra2 c.95.1.0 (A:229-383) automated matches {Rheum palmatum [TaxId: 137221]}
ifelvstaqtivpeshgaieghllesglsfhlyktvptlisnniktclsdaftplnisdw
nslfwiahpggpaildqvtakvglekeklkvtrqvlkdygnmssatvffimdemrkksle
ngqattgeglewgvlfgfgpgitvetvvlrsvpvi

SCOPe Domain Coordinates for d3a5ra2:

Click to download the PDB-style file with coordinates for d3a5ra2.
(The format of our PDB-style files is described here.)

Timeline for d3a5ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a5ra1