SCOPe 2.03: Domain d3a5ja_: 3a5j A:

Lineage for d3a5ja_ (3a5j A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (15 PDB entries)

8. Domain d3a5ja_: 3a5j A: [208111]
   automated match to d1xboa_
   complexed with mg

Details for d3a5ja_

PDB Entry: 3a5j, 1.7 Å

PDB Description: crystal structure of protein-tyrosine phosphatase 1b

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d3a5ja_:

Sequence; same for both SEQRES and ATOM records:

>d3a5ja_ c.45.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

Timeline for d3a5ja_:

• d3a5ja_ is new in SCOPe 2.03-stable
  
• d3a5ja_ appears in SCOPe 2.04
  
• d3a5ja_ appears in the current release, SCOPe 2.08, called d3a5ja1