SCOP 1.63: Domain d1g6rh1: 1g6r H:182-274

Lineage for d1g6rh1 (1g6r H:182-274)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)

8. Domain d1g6rh1: 1g6r H:182-274 [20811]
   Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh2, d1g6ri2

Details for d1g6rh1

PDB Entry: 1g6r, 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rh1:

Sequence; same for both SEQRES and ATOM records:

>d1g6rh1 b.1.1.2 (H:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1g6rh1:

• d1g6rh1 first appeared (with stable ids) in SCOP 1.55
  
• d1g6rh1 appears in SCOP 1.61
  
• d1g6rh1 appears in SCOP 1.65
  
• d1g6rh1 appears in the current release, SCOPe 2.08