Lineage for d3a5ba_ (3a5b A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689580Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)
  8. 2689584Domain d3a5ba_: 3a5b A: [208109]
    automated match to d1x3ka_
    complexed with hem

Details for d3a5ba_

PDB Entry: 3a5b (more details), 1.81 Å

PDB Description: Crystal structure of a hemoglobin component V from Propsilocerus akamusi (pH6.5 coordinates)
PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d3a5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5ba_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs

SCOPe Domain Coordinates for d3a5ba_:

Click to download the PDB-style file with coordinates for d3a5ba_.
(The format of our PDB-style files is described here.)

Timeline for d3a5ba_: