| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries) |
| Domain d3a5aa_: 3a5a A: [208108] automated match to d1x3ka_ complexed with hem |
PDB Entry: 3a5a (more details), 1.83 Å
SCOPe Domain Sequences for d3a5aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5aa_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs
Timeline for d3a5aa_: