Lineage for d3a4tb_ (3a4t B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130799Species Methanocaldococcus jannaschii [TaxId:2190] [225914] (2 PDB entries)
  8. 2130802Domain d3a4tb_: 3a4t B: [208106]
    automated match to d2b9ea1
    complexed with sfg

Details for d3a4tb_

PDB Entry: 3a4t (more details), 2.3 Å

PDB Description: Crystal structure of aTrm4 from M.jannaschii with sinefungin
PDB Compounds: (B:) Putative methyltransferase MJ0026

SCOPe Domain Sequences for d3a4tb_:

Sequence, based on SEQRES records: (download)

>d3a4tb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqs
issmippivlnpreddfildmcaapggktthlaqlmknkgtivaveisktrtkalksnin
rmgvlntiiinadmrkykdyllkneiffdkilldapcsgniikdknrnvseedikycslr
qkelidigidllkkdgelvystcsmeveeneevikyilqkrndveliiikanefkginik
egyikgtlrvfppnepffiaklrki

Sequence, based on observed residues (ATOM records): (download)

>d3a4tb_ c.66.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqs
issmippivlnpreddfildmcaapggktthlaqlmknkgtivaveisktrtkalksnin
rmgvlntiiinadmrkykdyllkneiffdkilldapcsgndikycslrqkelidigidll
kkdgelvystcsmeveeneevikyilqkrndveliiikanefkginikegyikgtlrvfp
pnepffiaklrki

SCOPe Domain Coordinates for d3a4tb_:

Click to download the PDB-style file with coordinates for d3a4tb_.
(The format of our PDB-style files is described here.)

Timeline for d3a4tb_: