Lineage for d2ckbm_ (2ckb M:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452578Protein beta2-microglobulin [88600] (4 species)
  7. 452709Species Mouse (Mus musculus) [TaxId:10090] [88603] (60 PDB entries)
  8. 452800Domain d2ckbm_: 2ckb M: [20810]
    Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2

Details for d2ckbm_

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbm_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2ckbm_:

Click to download the PDB-style file with coordinates for d2ckbm_.
(The format of our PDB-style files is described here.)

Timeline for d2ckbm_: