| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein beta2-microglobulin [88600] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries) |
| Domain d2ckbm_: 2ckb M: [20810] Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2 |
PDB Entry: 2ckb (more details), 3.2 Å
SCOP Domain Sequences for d2ckbm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbm_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d2ckbm_: