Lineage for d2ckbm_ (2ckb M:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220647Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)
  8. 220705Domain d2ckbm_: 2ckb M: [20810]
    Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh2, d2ckbi2

Details for d2ckbm_

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbm_ b.1.1.2 (M:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2ckbm_:

Click to download the PDB-style file with coordinates for d2ckbm_.
(The format of our PDB-style files is described here.)

Timeline for d2ckbm_: