Lineage for d2ckbm1 (2ckb M:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 159007Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries)
  8. 159061Domain d2ckbm1: 2ckb M: [20810]
    Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh2, d2ckbi2

Details for d2ckbm1

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbm1 b.1.1.2 (M:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2ckbm1:

Click to download the PDB-style file with coordinates for d2ckbm1.
(The format of our PDB-style files is described here.)

Timeline for d2ckbm1: