![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
![]() | Protein automated matches [227006] (3 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:2261] [225778] (1 PDB entry) |
![]() | Domain d3a2fb2: 3a2f B:118-248 [208099] Other proteins in same PDB: d3a2fa1, d3a2fa2 automated match to d1ge8a2 protein/DNA complex; mutant |
PDB Entry: 3a2f (more details), 2.67 Å
SCOPe Domain Sequences for d3a2fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a2fb2 d.131.1.2 (B:118-248) automated matches {Pyrococcus furiosus [TaxId: 2261]} veemevdlpelpftakvvvlgevlkaavkaaslvsdsikfiarenefimkaegetqevei kltledeglldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdeg rltfllaprve
Timeline for d3a2fb2: