SCOPe 2.08: Domain d3a2fb1: 3a2f B:2-117

Lineage for d3a2fb1 (3a2f B:2-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Pyrococcus furiosus [TaxId:2261] [55992] (5 PDB entries)

8. Domain d3a2fb1: 3a2f B:2-117 [208098]
   Other proteins in same PDB: d3a2fa1, d3a2fa2
   automated match to d1ge8a1
   protein/DNA complex; mutant

Details for d3a2fb1

PDB Entry: 3a2f, 2.67 Å

PDB Description: crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex

PDB Compounds: (B:) DNA polymerase sliding clamp

SCOPe Domain Sequences for d3a2fb1:

Sequence; same for both SEQRES and ATOM records:

>d3a2fb1 d.131.1.2 (B:2-117) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplid

Timeline for d3a2fb1:

• d3a2fb1 first appeared in SCOPe 2.03
  
• d3a2fb1 appears in SCOPe 2.07