Lineage for d3a2fa2 (3a2f A:348-773)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1953148Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 1953149Protein automated matches [226844] (5 species)
    not a true protein
  7. 1953185Species Pyrococcus furiosus [TaxId:2261] [224944] (3 PDB entries)
  8. 1953188Domain d3a2fa2: 3a2f A:348-773 [208097]
    Other proteins in same PDB: d3a2fa1, d3a2fb1, d3a2fb2
    automated match to d2vwja2
    protein/DNA complex; mutant

Details for d3a2fa2

PDB Entry: 3a2f (more details), 2.67 Å

PDB Description: crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3a2fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a2fa2 e.8.1.0 (A:348-773) automated matches {Pyrococcus furiosus [TaxId: 2261]}
stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwenivyldfr
alypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk
mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk
eleekfgfkvlyidtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrg
ffvtkkryavideegkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkev
iqklanyeippeklaiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrg
dgpisnrailaeeydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvglt
swlnik

SCOPe Domain Coordinates for d3a2fa2:

Click to download the PDB-style file with coordinates for d3a2fa2.
(The format of our PDB-style files is described here.)

Timeline for d3a2fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a2fa1