SCOPe 2.08: Domain d3a2fa2: 3a2f A:348-773

Lineage for d3a2fa2 (3a2f A:348-773)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.0: automated matches [227142] (1 protein)
   not a true family

6. Protein automated matches [226844] (11 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [224944] (3 PDB entries)

8. Domain d3a2fa2: 3a2f A:348-773 [208097]
   Other proteins in same PDB: d3a2fa1, d3a2fb1, d3a2fb2
   automated match to d2vwja2
   protein/DNA complex; mutant

Details for d3a2fa2

PDB Entry: 3a2f, 2.67 Å

PDB Description: crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3a2fa2:

Sequence; same for both SEQRES and ATOM records:

>d3a2fa2 e.8.1.0 (A:348-773) automated matches {Pyrococcus furiosus [TaxId: 2261]}
stgnlvewfllrkayernevapnkpseeeyqrrlresytggfvkepekglwenivyldfr
alypsiiithnvspdtlnlegcknydiapqvghkfckdipgfipsllghlleerqkiktk
mketqdpiekilldyrqkaikllansfygyygyakarwyckecaesvtawgrkyielvwk
eleekfgfkvlyidtdglyatipggeseeikkkalefvkyinsklpglleleyegfykrg
ffvtkkryavideegkvitrgleivrrdwseiaketqarvletilkhgdveeavrivkev
iqklanyeippeklaiyeqitrplheykaigphvavakklaakgvkikpgmvigyivlrg
dgpisnrailaeeydpkkhkydaeyyienqvlpavlrilegfgyrkedlryqktrqvglt
swlnik

Timeline for d3a2fa2:

• d3a2fa2 first appeared in SCOPe 2.03
  
• d3a2fa2 appears in SCOPe 2.07