Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries) |
Domain d3a2fa1: 3a2f A:1-347 [208096] Other proteins in same PDB: d3a2fa2, d3a2fb1, d3a2fb2 automated match to d2vwja1 protein/DNA complex; mutant |
PDB Entry: 3a2f (more details), 2.67 Å
SCOPe Domain Sequences for d3a2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a2fa1 c.55.3.0 (A:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]} mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg kivrivdvekvekkflgkpitvwklylehpqdvptirekvrehpavvdifeydipfakry lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadeneakvitwknidlpy vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrs
Timeline for d3a2fa1: