Lineage for d2ckbi1 (2ckb I:182-274)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548690Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries)
  8. 548792Domain d2ckbi1: 2ckb I:182-274 [20809]
    Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh2, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbi1

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbi1 b.1.1.2 (I:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d2ckbi1:

Click to download the PDB-style file with coordinates for d2ckbi1.
(The format of our PDB-style files is described here.)

Timeline for d2ckbi1: