Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries) |
Domain d2ckbi1: 2ckb I:182-274 [20809] Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh2, d2ckbi2 |
PDB Entry: 2ckb (more details), 3.2 Å
SCOP Domain Sequences for d2ckbi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbi1 b.1.1.2 (I:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d2ckbi1: