SCOPe 2.07: Domain d3a2ba_: 3a2b A:

Lineage for d3a2ba_ (3a2b A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Sphingobacterium multivorum [TaxId:28454] [225699] (1 PDB entry)

8. Domain d3a2ba_: 3a2b A: [208083]
   automated match to d3tqxb_
   complexed with plp, ser

Details for d3a2ba_

PDB Entry: 3a2b, 2.3 Å

PDB Description: Crystal Structure of Serine Palmitoyltransferase from Sphingobacterium multivorum with substrate L-serine

PDB Compounds: (A:) serine palmitoyltransferase

SCOPe Domain Sequences for d3a2ba_:

Sequence; same for both SEQRES and ATOM records:

>d3a2ba_ c.67.1.0 (A:) automated matches {Sphingobacterium multivorum [TaxId: 28454]}
skgklgekisqfkiveelkakglyayfrpiqskqdtevkidgrrvlmfgsnsylglttdt
riikaaqdalekygtgcagsrflngtldihveleeklsayvgkeaailfstgfqsnlgpl
sclmgrndyillderdhasiidgsrlsfskvikyghnnmedlraklsrlpedsaklictd
gifsmegdivnlpeltsianefdaavmvddahslgvighkgagtashfglnddvdlimgt
fskslaslggfvagdadvidflkhnarsvmfsasmtpasvastlkaleiiqnepehiekl
wkntdyakaqlldhgfdlgatespilpifirsnektfwvtkmlqddgvfvnpvvspavpa
eeslirfslmathtydqideaiekmvkvfkqa

Timeline for d3a2ba_:

• d3a2ba_ first appeared in SCOPe 2.03
  
• d3a2ba_ appears in SCOPe 2.06
  
• d3a2ba_ appears in the current release, SCOPe 2.08