![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries) Uniprot P01887 |
![]() | Domain d2ckbl_: 2ckb L: [20808] Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2 |
PDB Entry: 2ckb (more details), 3 Å
SCOP Domain Sequences for d2ckbl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbl_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d2ckbl_: