Lineage for d2ckbl1 (2ckb L:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) 
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries) 
Domain d2ckbl1: 2ckb L: [20808]
Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh2, d2ckbi2
Details for d2ckbl1
PDB Entry: 2ckb (more details), 3.2 Å
PDB Description: structure of the 2c/kb/dev8 complex
SCOP Domain Sequences for d2ckbl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckbl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d2ckbl1:
Click to download the PDB-style file with coordinates for d2ckbl1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ckbl1:
- d2ckbl1 first appeared (with stable ids) in SCOP 1.55
- d2ckbl1 appears in SCOP 1.59
- d2ckbl1 appears in the current release, SCOPe 2.08, called d2ckbl_
View in 3D
