Lineage for d3a13g2 (3a13 G:136-444)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838971Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2838972Protein automated matches [227123] (9 species)
    not a true protein
  7. 2839001Species Pyrococcus kodakaraensis [TaxId:69014] [226763] (2 PDB entries)
  8. 2839008Domain d3a13g2: 3a13 G:136-444 [208074]
    Other proteins in same PDB: d3a13a1, d3a13b1, d3a13c1, d3a13d1, d3a13e1, d3a13f1, d3a13g1, d3a13h1, d3a13i1, d3a13j1
    automated match to d1bxna1
    complexed with ca, cap, mg; mutant

Details for d3a13g2

PDB Entry: 3a13 (more details), 2.34 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
PDB Compounds: (G:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a13g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a13g2 c.1.14.0 (G:136-444) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditiqnarilreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

SCOPe Domain Coordinates for d3a13g2:

Click to download the PDB-style file with coordinates for d3a13g2.
(The format of our PDB-style files is described here.)

Timeline for d3a13g2: