SCOP 1.65: Domain d2ckbh1: 2ckb H:182-274

Lineage for d2ckbh1 (2ckb H:182-274)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (49 PDB entries)

8. Domain d2ckbh1: 2ckb H:182-274 [20807]
   Other proteins in same PDB: d2ckba1, d2ckba2, d2ckbb1, d2ckbb2, d2ckbc1, d2ckbc2, d2ckbd1, d2ckbd2, d2ckbh2, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbh1

PDB Entry: 2ckb, 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbh1:

Sequence; same for both SEQRES and ATOM records:

>d2ckbh1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d2ckbh1:

• d2ckbh1 first appeared (with stable ids) in SCOP 1.55
  
• d2ckbh1 appears in SCOP 1.63
  
• d2ckbh1 appears in SCOP 1.67
  
• d2ckbh1 appears in the current release, SCOPe 2.08