Lineage for d3a13c1 (3a13 C:7-135)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416218Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1416470Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1416471Protein automated matches [226983] (10 species)
    not a true protein
  7. 1416520Species Pyrococcus kodakaraensis [TaxId:69014] [225861] (1 PDB entry)
  8. 1416523Domain d3a13c1: 3a13 C:7-135 [208065]
    Other proteins in same PDB: d3a13a2, d3a13b2, d3a13c2, d3a13d2, d3a13e2, d3a13f2, d3a13g2, d3a13h2, d3a13i2, d3a13j2
    automated match to d1bxna2
    complexed with ca, cap, mg; mutant

Details for d3a13c1

PDB Entry: 3a13 (more details), 2.34 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a13c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a13c1 d.58.9.0 (C:7-135) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
yfpeklire

SCOPe Domain Coordinates for d3a13c1:

Click to download the PDB-style file with coordinates for d3a13c1.
(The format of our PDB-style files is described here.)

Timeline for d3a13c1: