Lineage for d3a13a1 (3a13 A:9-135)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652842Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1653034Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1653035Protein automated matches [226983] (12 species)
    not a true protein
  7. 1653145Species Pyrococcus kodakaraensis [TaxId:69014] [225861] (1 PDB entry)
  8. 1653146Domain d3a13a1: 3a13 A:9-135 [208061]
    Other proteins in same PDB: d3a13a2, d3a13b2, d3a13c2, d3a13d2, d3a13e2, d3a13f2, d3a13g2, d3a13h2, d3a13i2, d3a13j2
    automated match to d1bxna2
    complexed with ca, cap, mg; mutant

Details for d3a13a1

PDB Entry: 3a13 (more details), 2.34 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp and activated with ca
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a13a1 d.58.9.0 (A:9-135) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
peklire

SCOPe Domain Coordinates for d3a13a1:

Click to download the PDB-style file with coordinates for d3a13a1.
(The format of our PDB-style files is described here.)

Timeline for d3a13a1: