![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (10 species) not a true protein |
![]() | Species Pyrococcus kodakaraensis [TaxId:69014] [225861] (1 PDB entry) |
![]() | Domain d3a13a1: 3a13 A:9-135 [208061] Other proteins in same PDB: d3a13a2, d3a13b2, d3a13c2, d3a13d2, d3a13e2, d3a13f2, d3a13g2, d3a13h2, d3a13i2, d3a13j2 automated match to d1bxna2 complexed with ca, cap, mg; mutant |
PDB Entry: 3a13 (more details), 2.34 Å
SCOPe Domain Sequences for d3a13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a13a1 d.58.9.0 (A:9-135) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]} ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf peklire
Timeline for d3a13a1: