Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species) |
Species Thermococcus kodakaraensis [TaxId:311400] [69404] (2 PDB entries) |
Domain d3a12j2: 3a12 J:137-444 [208060] Other proteins in same PDB: d3a12a1, d3a12b1, d3a12c1, d3a12d1, d3a12e1, d3a12f1, d3a12g1, d3a12h1, d3a12i1, d3a12j1 automated match to d1geha1 complexed with cap, mg |
PDB Entry: 3a12 (more details), 2.3 Å
SCOPe Domain Sequences for d3a12j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a12j2 c.1.14.1 (J:137-444) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]} dgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlts pwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvdv vitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhvg tagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale kwghvtpv
Timeline for d3a12j2: