Lineage for d3a12j2 (3a12 J:137-444)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838501Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 2838704Species Thermococcus kodakaraensis [TaxId:311400] [69404] (2 PDB entries)
  8. 2838714Domain d3a12j2: 3a12 J:137-444 [208060]
    Other proteins in same PDB: d3a12a1, d3a12b1, d3a12c1, d3a12d1, d3a12e1, d3a12f1, d3a12g1, d3a12h1, d3a12i1, d3a12j1
    automated match to d1geha1
    complexed with cap, mg

Details for d3a12j2

PDB Entry: 3a12 (more details), 2.3 Å

PDB Description: Crystal structure of Type III Rubisco complexed with 2-CABP
PDB Compounds: (J:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a12j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a12j2 c.1.14.1 (J:137-444) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
dgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlts
pwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvdv
vitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhvg
tagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgniq
pviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelarale
kwghvtpv

SCOPe Domain Coordinates for d3a12j2:

Click to download the PDB-style file with coordinates for d3a12j2.
(The format of our PDB-style files is described here.)

Timeline for d3a12j2: