SCOP 1.67: Domain d2mhad_: 2mha D:

Lineage for d2mhad_ (2mha D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries)

8. Domain d2mhad_: 2mha D: [20806]
   Other proteins in same PDB: d2mhaa1, d2mhaa2, d2mhac1, d2mhac2

Details for d2mhad_

PDB Entry: 2mha, 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhad_:

Sequence; same for both SEQRES and ATOM records:

>d2mhad_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2mhad_:

• d2mhad_ first appeared (with stable ids) in SCOP 1.55, called d2mhad1
  
• d2mhad_ appears in SCOP 1.65
  
• d2mhad_ appears in SCOP 1.69
  
• d2mhad_ appears in the current release, SCOPe 2.08