Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species) |
Species Thermococcus kodakaraensis [TaxId:311400] [69731] (2 PDB entries) |
Domain d3a12h1: 3a12 H:8-136 [208055] Other proteins in same PDB: d3a12a2, d3a12b2, d3a12c2, d3a12d2, d3a12e2, d3a12f2, d3a12g2, d3a12h2, d3a12i2, d3a12j2 automated match to d1geha2 complexed with cap, mg |
PDB Entry: 3a12 (more details), 2.3 Å
SCOPe Domain Sequences for d3a12h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a12h1 d.58.9.1 (H:8-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]} iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly fpekliref
Timeline for d3a12h1: