SCOPe 2.08: Domain d3a12c1: 3a12 C:7-136

Lineage for d3a12c1 (3a12 C:7-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)

7. Species Thermococcus kodakaraensis [TaxId:311400] [69731] (2 PDB entries)

8. Domain d3a12c1: 3a12 C:7-136 [208045]
   Other proteins in same PDB: d3a12a2, d3a12b2, d3a12c2, d3a12d2, d3a12e2, d3a12f2, d3a12g2, d3a12h2, d3a12i2, d3a12j2
   automated match to d1geha2
   complexed with cap, mg

Details for d3a12c1

PDB Entry: 3a12, 2.3 Å

PDB Description: Crystal structure of Type III Rubisco complexed with 2-CABP

PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3a12c1:

Sequence; same for both SEQRES and ATOM records:

>d3a12c1 d.58.9.1 (C:7-136) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Thermococcus kodakaraensis [TaxId: 311400]}
tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
yfpekliref

Timeline for d3a12c1:

• d3a12c1 first appeared in SCOPe 2.03
  
• d3a12c1 appears in SCOPe 2.07