SCOPe 2.07: Domain d2mhab_: 2mha B:

Lineage for d2mhab_ (2mha B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d2mhab_: 2mha B: [20804]
   Other proteins in same PDB: d2mhaa1, d2mhaa2, d2mhac1, d2mhac2

Details for d2mhab_

PDB Entry: 2mha, 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

PDB Compounds: (B:) beta 2-microglobulin

SCOPe Domain Sequences for d2mhab_:

Sequence; same for both SEQRES and ATOM records:

>d2mhab_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2mhab_:

• d2mhab_ first appeared (with stable ids) in SCOP 1.55, called d2mhab1
  
• d2mhab_ appears in SCOPe 2.06
  
• d2mhab_ appears in the current release, SCOPe 2.08