Lineage for d2mhab_ (2mha B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784343Domain d2mhab_: 2mha B: [20804]
    Other proteins in same PDB: d2mhaa1, d2mhaa2, d2mhac1, d2mhac2

Details for d2mhab_

PDB Entry: 2mha (more details), 2.5 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition
PDB Compounds: (B:) beta 2-microglobulin

SCOP Domain Sequences for d2mhab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhab_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d2mhab_:

Click to download the PDB-style file with coordinates for d2mhab_.
(The format of our PDB-style files is described here.)

Timeline for d2mhab_: