![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (21 species) not a true protein |
![]() | Species Streptococcus agalactiae [TaxId:1311] [225654] (1 PDB entry) |
![]() | Domain d2zzra_: 2zzr A: [208036] automated match to d2fuza_ complexed with gol, so4 |
PDB Entry: 2zzr (more details), 1.75 Å
SCOPe Domain Sequences for d2zzra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zzra_ a.102.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]} mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgflyt psctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllniq llffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgysd esswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgq prdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplllh gvyswhsgkgvdegniwgdyyylealirfykdwelyw
Timeline for d2zzra_: