Lineage for d2zzra_ (2zzr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722379Species Streptococcus agalactiae [TaxId:1311] [225654] (1 PDB entry)
  8. 2722380Domain d2zzra_: 2zzr A: [208036]
    automated match to d2fuza_
    complexed with gol, so4

Details for d2zzra_

PDB Entry: 2zzr (more details), 1.75 Å

PDB Description: Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae
PDB Compounds: (A:) unsaturated glucuronyl hydrolase

SCOPe Domain Sequences for d2zzra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zzra_ a.102.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}
mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgflyt
psctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllniq
llffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgysd
esswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgq
prdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplllh
gvyswhsgkgvdegniwgdyyylealirfykdwelyw

SCOPe Domain Coordinates for d2zzra_:

Click to download the PDB-style file with coordinates for d2zzra_.
(The format of our PDB-style files is described here.)

Timeline for d2zzra_: