SCOPe 2.08: Domain d2zz6b_: 2zz6 B:

Lineage for d2zz6b_ (2zz6 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries)

8. Domain d2zz6b_: 2zz6 B: [208034]
   automated match to d3li0b_
   complexed with 6az, gol

Details for d2zz6b_

PDB Entry: 2zz6, 1.66 Å

PDB Description: covalent complex of orotidine monophosphate decarboxylase from m. thermoautotrophicum with 6-azido-ump

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d2zz6b_:

Sequence; same for both SEQRES and ATOM records:

>d2zz6b_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdl

Timeline for d2zz6b_:

• d2zz6b_ first appeared in SCOPe 2.03
  
• d2zz6b_ appears in SCOPe 2.07