SCOP 1.69: Domain d2mhaa1: 2mha A:182-270

Lineage for d2mhaa1 (2mha A:182-270)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)

8. Domain d2mhaa1: 2mha A:182-270 [20803]
   Other proteins in same PDB: d2mhaa2, d2mhab_, d2mhac2, d2mhad_

Details for d2mhaa1

PDB Entry: 2mha, 2.8 Å

PDB Description: crystal structure of the major histocompatibility complex class i h- 2kb molecule containing a single viral peptide: implications for peptide binding and t-cell receptor recognition

SCOP Domain Sequences for d2mhaa1:

Sequence; same for both SEQRES and ATOM records:

>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepl

Timeline for d2mhaa1:

• d2mhaa1 first appeared (with stable ids) in SCOP 1.55
  
• d2mhaa1 appears in SCOP 1.67
  
• d2mhaa1 appears in SCOP 1.71
  
• d2mhaa1 appears in the current release, SCOPe 2.08