Lineage for d2zz2b_ (2zz2 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.3: Decarboxylase [51375] (4 proteins) Protein automated matches [190130] (11 species)
not a true protein
Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries) 
Domain d2zz2b_: 2zz2 B: [208026]
automated match to d3li0b_
complexed with 6cn, gol; mutant
Details for d2zz2b_
PDB Entry: 2zz2 (more details), 1.53 Å
PDB Description: orotidine monophosphate decarboxylase k72a mutant from m. thermoautotrophicum complexed with 6-cyano-ump
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylaseSCOPe Domain Sequences for d2zz2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zz2b_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
favadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdl
SCOPe Domain Coordinates for d2zz2b_:
Click to download the PDB-style file with coordinates for d2zz2b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2zz2b_:
- d2zz2b_ first appeared in SCOPe 2.03
- d2zz2b_ appears in SCOPe 2.07
View in 3D
