SCOPe 2.06: Domain d2zyoa_: 2zyo A:

Lineage for d2zyoa_ (2zyo A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [193732] (5 PDB entries)

8. Domain d2zyoa_: 2zyo A: [208021]
   automated match to d2zyma_

Details for d2zyoa_

PDB Entry: 2zyo, 1.55 Å

PDB Description: crystal structure of cyclo/maltodextrin-binding protein complexed with maltotetraose

PDB Compounds: (A:) Solute-binding protein

SCOPe Domain Sequences for d2zyoa_:

Sequence; same for both SEQRES and ATOM records:

>d2zyoa_ c.94.1.0 (A:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
ksegkpdklvvwenaddgvqlnntkkwageftkktgiqvevvpvallkqqekltldgpag
kgadlvtwphdrlgeavtkgllqpiqvdnsvknqfddvamkaltyggklyglpkaiesva
liynkklmgqvpatydelfqyakannkpdeqkygvlfeannfyytyflfaakgaavfkeq
dgtldpneiglnspeavqgmnevqkwftearlpqslkadtvnglfksgkvaavingpwai
kdyqaaginvgvaplpkidgkdaqtfigvkgwylsayskypkyatelmqfltskealasr
fketgeippqkellndpmiknnpvvngfakqaskgvpmpsipemgvvwepinnahtfvaq
gkqtpeqalndavkimkekiqtmkq

Timeline for d2zyoa_:

• d2zyoa_ first appeared in SCOPe 2.03
  
• d2zyoa_ appears in SCOPe 2.05
  
• d2zyoa_ appears in SCOPe 2.07
  
• d2zyoa_ appears in the current release, SCOPe 2.08