Lineage for d1bqhe_ (1bqh E:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288544Protein beta2-microglobulin [88600] (4 species)
  7. 288646Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)
  8. 288692Domain d1bqhe_: 1bqh E: [20802]
    Other proteins in same PDB: d1bqha1, d1bqha2, d1bqhd1, d1bqhd2, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_
    complexed with nag

Details for d1bqhe_

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhe_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1bqhe_:

Click to download the PDB-style file with coordinates for d1bqhe_.
(The format of our PDB-style files is described here.)

Timeline for d1bqhe_: