SCOPe 2.06: Domain d2zykc_: 2zyk C:

Lineage for d2zykc_ (2zyk C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [193732] (5 PDB entries)

8. Domain d2zykc_: 2zyk C: [208018]
   automated match to d2zyma_

Details for d2zykc_

PDB Entry: 2zyk, 2.5 Å

PDB Description: crystal structure of cyclo/maltodextrin-binding protein complexed with gamma-cyclodextrin

PDB Compounds: (C:) Solute-binding protein

SCOPe Domain Sequences for d2zykc_:

Sequence; same for both SEQRES and ATOM records:

>d2zykc_ c.94.1.0 (C:) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
kpdklvvwenaddgvqlnntkkwageftkktgiqvevvpvallkqqekltldgpagkgad
lvtwphdrlgeavtkgllqpiqvdnsvknqfddvamkaltyggklyglpkaiesvaliyn
kklmgqvpatydelfqyakannkpdeqkygvlfeannfyytyflfaakgaavfkeqdgtl
dpneiglnspeavqgmnevqkwftearlpqslkadtvnglfksgkvaavingpwaikdyq
aaginvgvaplpkidgkdaqtfigvkgwylsayskypkyatelmqfltskealasrfket
geippqkellndpmiknnpvvngfakqaskgvpmpsipemgvvwepinnahtfvaqgkqt
peqalndavkimkekiqtmkq

Timeline for d2zykc_:

• d2zykc_ first appeared in SCOPe 2.03
  
• d2zykc_ appears in SCOPe 2.05
  
• d2zykc_ appears in SCOPe 2.07
  
• d2zykc_ appears in the current release, SCOPe 2.08