Lineage for d2zygb2 (2zyg B:177-467)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721770Species Klebsiella pneumoniae [TaxId:573] [225754] (1 PDB entry)
  8. 2721772Domain d2zygb2: 2zyg B:177-467 [208015]
    Other proteins in same PDB: d2zyga1, d2zygb1
    automated match to d1pgja1

Details for d2zygb2

PDB Entry: 2zyg (more details), 2.1 Å

PDB Description: apo-form of dimeric 6-phosphogluconate dehydrogenase
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zygb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zygb2 a.100.1.0 (B:177-467) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gaghyvkmvhngieygdmqliaeayallkgglalsneelaqtftewnegelssyliditk
diftkkdeegkylvdvildeaankgtgkwtsqssldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraasdeynwdlnygei
akifragciiraqflqkitdayaqnagianlllapyfkqiaddyqqalrdvvayavqngi
pvptfsaaiayydsyrsavlpanliqaqrdyfgahtykrtdkegifhtewl

SCOPe Domain Coordinates for d2zygb2:

Click to download the PDB-style file with coordinates for d2zygb2.
(The format of our PDB-style files is described here.)

Timeline for d2zygb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zygb1