![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [225754] (1 PDB entry) |
![]() | Domain d2zygb2: 2zyg B:177-467 [208015] Other proteins in same PDB: d2zyga1, d2zygb1 automated match to d1pgja1 |
PDB Entry: 2zyg (more details), 2.1 Å
SCOPe Domain Sequences for d2zygb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zygb2 a.100.1.0 (B:177-467) automated matches {Klebsiella pneumoniae [TaxId: 573]} gaghyvkmvhngieygdmqliaeayallkgglalsneelaqtftewnegelssyliditk diftkkdeegkylvdvildeaankgtgkwtsqssldlgeplslitesvfaryisslkdqr vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraasdeynwdlnygei akifragciiraqflqkitdayaqnagianlllapyfkqiaddyqqalrdvvayavqngi pvptfsaaiayydsyrsavlpanliqaqrdyfgahtykrtdkegifhtewl
Timeline for d2zygb2: