Lineage for d2zygb1 (2zyg B:2-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847426Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries)
  8. 2847430Domain d2zygb1: 2zyg B:2-176 [208014]
    Other proteins in same PDB: d2zyga2, d2zygb2
    automated match to d1pgja2

Details for d2zygb1

PDB Entry: 2zyg (more details), 2.1 Å

PDB Description: apo-form of dimeric 6-phosphogluconate dehydrogenase
PDB Compounds: (B:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zygb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zygb1 c.2.1.0 (B:2-176) automated matches {Klebsiella pneumoniae [TaxId: 573]}
skqqigvvgmavmgrnlalniesrgytvsvfnrsrekteeviaenpgkklvpyytvqefv
esletprrillmvkagagtdsaidslkpyldkgdiiidggntffqdtirrnrelsaegfn
figtgvsggeegtlkgpsimpggqkeayelvapilkqiaavaedgepcvtyigad

SCOPe Domain Coordinates for d2zygb1:

Click to download the PDB-style file with coordinates for d2zygb1.
(The format of our PDB-style files is described here.)

Timeline for d2zygb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zygb2