Lineage for d2zyga1 (2zyg A:3-176)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847426Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries)
  8. 2847429Domain d2zyga1: 2zyg A:3-176 [208012]
    Other proteins in same PDB: d2zyga2, d2zygb2
    automated match to d1pgja2

Details for d2zyga1

PDB Entry: 2zyg (more details), 2.1 Å

PDB Description: apo-form of dimeric 6-phosphogluconate dehydrogenase
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zyga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zyga1 c.2.1.0 (A:3-176) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kqqigvvgmavmgrnlalniesrgytvsvfnrsrekteeviaenpgkklvpyytvqefve
sletprrillmvkagagtdsaidslkpyldkgdiiidggntffqdtirrnrelsaegfnf
igtgvsggeegtlkgpsimpggqkeayelvapilkqiaavaedgepcvtyigad

SCOPe Domain Coordinates for d2zyga1:

Click to download the PDB-style file with coordinates for d2zyga1.
(The format of our PDB-style files is described here.)

Timeline for d2zyga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zyga2