| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Klebsiella pneumoniae [TaxId:573] [225753] (5 PDB entries) |
| Domain d2zyga1: 2zyg A:3-176 [208012] Other proteins in same PDB: d2zyga2, d2zygb2 automated match to d1pgja2 |
PDB Entry: 2zyg (more details), 2.1 Å
SCOPe Domain Sequences for d2zyga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zyga1 c.2.1.0 (A:3-176) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kqqigvvgmavmgrnlalniesrgytvsvfnrsrekteeviaenpgkklvpyytvqefve
sletprrillmvkagagtdsaidslkpyldkgdiiidggntffqdtirrnrelsaegfnf
igtgvsggeegtlkgpsimpggqkeayelvapilkqiaavaedgepcvtyigad
Timeline for d2zyga1: