SCOPe 2.03: Domain d2zyda1: 2zyd A:3-176

Lineage for d2zyda1 (2zyd A:3-176)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225273] (5 PDB entries)

8. Domain d2zyda1: 2zyd A:3-176 [208008]
   Other proteins in same PDB: d2zyda2, d2zydb2
   automated match to d1pgja2
   complexed with glo

Details for d2zyda1

PDB Entry: 2zyd, 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with glucose

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zyda1:

Sequence; same for both SEQRES and ATOM records:

>d2zyda1 c.2.1.0 (A:3-176) automated matches {Escherichia coli [TaxId: 83333]}
kqqigvvgmavmgrnlalniesrgytvsifnrsrekteeviaenpgkklvpyytvkefve
sletprrillmvkagagtdaaidslkpyldkgdiiidggntffqdtirrnrelsaegfnf
igtgvsggeegalkgpsimpggqkeayelvapiltkiaavaedgepcvtyigad

Timeline for d2zyda1:

• d2zyda1 is new in SCOPe 2.03-stable
  
• d2zyda1 appears in SCOPe 2.04
  
• d2zyda1 appears in the current release, SCOPe 2.08