Class a: All alpha proteins [46456] (290 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries) |
Domain d2zyab2: 2zya B:177-467 [208007] Other proteins in same PDB: d2zyaa1, d2zyab1 automated match to d1pgja1 complexed with 6pg |
PDB Entry: 2zya (more details), 1.6 Å
SCOPe Domain Sequences for d2zyab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zyab2 a.100.1.0 (B:177-467) automated matches {Escherichia coli K-12 [TaxId: 83333]} gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei akifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngi pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtewl
Timeline for d2zyab2: